DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and Mysm1

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_017175747.1 Gene:Mysm1 / 320713 MGIID:2444584 Length:824 Species:Mus musculus


Alignment Length:232 Identity:47/232 - (20%)
Similarity:79/232 - (34%) Gaps:47/232 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FQVVDAFER---RNADSH----RVIGTLLGS-------VDKGVVEVTNCFCVP--------HKEH 58
            |||..|.|.   .|..:|    .|||.|.|.       ::..:::|  |...|        ..|.
Mouse   566 FQVKVAAEALLIMNLHAHVSMAEVIGLLGGRYSEADKVLENNLLQV--CAAEPCNSLSTGLQCEM 628

  Fly    59 D--DQVEAELSYALDMYDLNRKVNSNESVVGWWATG---------NDVTNHSSVIHEYYARECNN 112
            |  .|.:|..:.||..|          ||:||:.:.         .|:...:. ...|::|....
Mouse   629 DPVSQTQASETLALRGY----------SVIGWYHSHPAFDPNPSLRDIDTQAK-YQSYFSRGGAK 682

  Fly   113 PVHLTVDTSLQGGRMGLRAYVCIQLGVPGGKSGCMFTPIPVELTSYEPETFGLKLLQKTVGVSPA 177
            .:.:.|....:...:......|:.:.......|....|...|:.....|.....:.:||..:...
Mouse   683 FIGMIVSPYNRSNPLPYSQITCLVISEEVSPDGTYRLPYKFEVQQMLEEPQWELVFEKTRWIIEK 747

  Fly   178 HR-PKTVPPMLDLAQISEASTKLQSLLDLILKYVDDV 213
            :| ..:..||..:.:.....|.||.||:.:.|.:..|
Mouse   748 YRLSNSSVPMDRIFRRDSDLTCLQKLLECLRKTLSKV 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 47/232 (20%)
Mysm1XP_017175747.1 Myb_DNA-binding 116..160 CDD:365977
SWIRM 373..452 CDD:367940
MPN_2A_DUB 562..749 CDD:163698 37/195 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.