DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and Psmd7

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001100896.1 Gene:Psmd7 / 307821 RGDID:1306902 Length:320 Species:Rattus norvegicus


Alignment Length:286 Identity:83/286 - (29%)
Similarity:141/286 - (49%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VRVHPVVLFQVVDAFER--RNADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEA----EL 66
            |.|||:||..|||.|.|  :..:..||:|.||||..|.|::|:|.|.||..| ||:.::    :.
  Rat     9 VVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE-DDKDDSVWFLDH 72

  Fly    67 SYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYARECNNPVHLTVDTSLQGGRMGLRA 131
            .|..:||.:.:|||:.|.:|||:.||..:..:...|:|...|.|.|.|.:.:|...:...:...|
  Rat    73 DYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEA 137

  Fly   132 YVCIQL----GVPGGKSGCMFTPIPVELTSYEPETFGLKLLQK-----TVGVSPAHRPKTVPPML 187
            |:.::.    |.|..|:   |..:..|:.:.|.|..|::.|.:     |||.........|..:.
  Rat   138 YISVEEVHDDGTPTSKT---FEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLK 199

  Fly   188 DLAQISEASTKLQSLLDLILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVR 252
            .|.         ..||| |..|::.|.:.|:..::.:..||.|:.:.:|..:.::|.:.|.....
  Rat   200 GLN---------SKLLD-IRTYLEKVASGKLPINHHIIYQLQDVFNLLPDASLQEFVKAFYLKTN 254

  Fly   253 NLLLVITLSQLIKTQLQL----NEKL 274
            :.::|:.|:.||::.:.|    |.|:
  Rat   255 DQMVVVYLASLIRSVVALHNLINNKI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 82/284 (29%)
Psmd7NP_001100896.1 MPN_RPN7_8 7..285 CDD:163693 83/286 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D455272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.