DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and Cops6

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001100599.1 Gene:Cops6 / 304343 RGDID:1309919 Length:344 Species:Rattus norvegicus


Alignment Length:271 Identity:58/271 - (21%)
Similarity:120/271 - (44%) Gaps:7/271 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLTVRVHPVVLFQVVDAFERRNADSHR---VIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAEL 66
            :::|.:||:|:..:.|.:.|..:...|   |||.|:|..:...:||.|.|.:.....:.::..:.
  Rat    55 SVSVALHPLVILNISDHWIRMRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSHTVEKKIIIDK 119

  Fly    67 SYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYARECNNPVHLTVDTSLQGGRMGLRA 131
            .|.....:..::|......:||:.||.........:|:.......:|:.|.::...:...:.:..
  Rat   120 EYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSV 184

  Fly   132 YVCIQLGVPGGKSGCMFTPIPVELTSYEPETFGLKLLQKTVGVSPAHRPKTVPPMLDLAQISEAS 196
            :..: :.:..|::..:|..:...|.:.|.|..|:..:.:......... .||...| :||.| |.
  Rat   185 FESV-IDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGEN-STVAEHL-IAQHS-AI 245

  Fly   197 TKLQSLLDLILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVRNLLLVITLS 261
            ..|.|.:.|||:||....|.:|..::.:.|:...|.|.:|.::.::|...|.....::.|:..|.
  Rat   246 KMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLG 310

  Fly   262 QLIKTQLQLNE 272
            .:.||...:|:
  Rat   311 TITKTCNTMNQ 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 58/268 (22%)
Cops6NP_001100599.1 MPN_CSN6 56..338 CDD:163694 58/270 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.