DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and Mysm1

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_008762133.1 Gene:Mysm1 / 298247 RGDID:1311787 Length:811 Species:Rattus norvegicus


Alignment Length:268 Identity:51/268 - (19%)
Similarity:94/268 - (35%) Gaps:80/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KEHDDQVEAELSYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYA----RECNNPVHL 116
            :|.|..||.:::.|..                   .||| .|.:||..::|.    |..|..:..
  Rat     4 EEADVDVEGDVAAAAQ-------------------PGND-GNTASVFQDHYLDSTWRRENGCLPW 48

  Fly   117 TVDTSLQGGRMGL-------RAYVCIQLGVPG-----------------GKSGCMFTPIPVELTS 157
            |:|:::......:       ..|......:||                 .|:|.:....|.:.:|
  Rat    49 TLDSTISDENRAVIEKMLLEEEYYLSNKSLPGKFWVNQKENDKKCTNSLQKTGKIMVRSPAKPSS 113

  Fly   158 Y-------EPETF--GL-KLLQKTVGVSPAHRPKTVPPMLDLAQ----------ISEASTKLQSL 202
            |       |.:.|  || |..::...::...:.:||..:...|:          ..:.:..|:|.
  Rat   114 YSVKWTIEEKKLFEQGLAKFGRRWTKIAALVKSRTVLQVKSYARQYFRNKVKWGAEKETPTLKSN 178

  Fly   203 LDLILKYVDDVIAHKVTPD---NAVGRQLL------DLIHSVPHMTHEQFTQMFNANVRNLLLVI 258
            .||.:|..|:.....|..|   |||..:.|      |:...:..:|.:...:.:..   :|.|.:
  Rat   179 SDLQVKNKDERTKVWVASDPNLNAVKIEKLSDDEDVDITDELDELTSQTSQKNYGG---HLTLDV 240

  Fly   259 TLSQLIKT 266
            ..|::.||
  Rat   241 PSSKMYKT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 51/268 (19%)
Mysm1XP_008762133.1 Myb_DNA-binding 116..160 CDD:395191 8/43 (19%)
SWIRM 365..444 CDD:398234
MPN_2A_DUB 554..736 CDD:163698
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.