DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and Cops6

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_036132.1 Gene:Cops6 / 26893 MGIID:1349439 Length:324 Species:Mus musculus


Alignment Length:271 Identity:58/271 - (21%)
Similarity:121/271 - (44%) Gaps:7/271 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLTVRVHPVVLFQVVDAFERRNADSHR---VIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAEL 66
            :::|.:||:|:..:.|.:.|..:...|   |||.|:|..:...:||.|.|.:.....::::..:.
Mouse    35 SVSVALHPLVILNISDHWIRMRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDK 99

  Fly    67 SYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYARECNNPVHLTVDTSLQGGRMGLRA 131
            .|.....:..::|......:||:.||.........:|:.......:|:.|.::...:...:.:..
Mouse   100 EYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTDLPVSV 164

  Fly   132 YVCIQLGVPGGKSGCMFTPIPVELTSYEPETFGLKLLQKTVGVSPAHRPKTVPPMLDLAQISEAS 196
            :..: :.:..|::..:|..:...|.:.|.|..|:..:.:......... .||...| :||.| |.
Mouse   165 FESV-IDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGEN-STVAEHL-IAQHS-AI 225

  Fly   197 TKLQSLLDLILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVRNLLLVITLS 261
            ..|.|.:.|||:||....|.:|..::.:.|:...|.|.:|.::.::|...|.....::.|:..|.
Mouse   226 KMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLG 290

  Fly   262 QLIKTQLQLNE 272
            .:.||...:|:
Mouse   291 TITKTCNTMNQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 58/268 (22%)
Cops6NP_036132.1 MPN_CSN6 36..318 CDD:163694 58/270 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.