DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and csn-6

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001255725.1 Gene:csn-6 / 178289 WormBaseID:WBGene00000818 Length:431 Species:Caenorhabditis elegans


Alignment Length:280 Identity:60/280 - (21%)
Similarity:111/280 - (39%) Gaps:35/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VRVHPVVLFQVVDAFERRNADS----HRVIGTLLGSVDKGVVEVTNCFC--VPHKEHDDQVEAEL 66
            |.:||:|:.|:.:.:.|.....    .:|.|.:||..:...||..|.|.  :..:|..:.|....
 Worm    14 VLLHPLVIMQMSEHYSRTKVQQGPTVKKVFGAILGRQNGRQVEAINSFVLKMETEEMAEPVTFST 78

  Fly    67 SYALDMYDLNRKVNSNESVVGWWATGND-------------VTNHSSVIHEYYARECNNPVHLTV 118
            .:.|...|...:|.....|:|.:..|.|             :||  :|.:...|.:.:..:.|.:
 Worm    79 EHLLQRADQYLEVFPELQVIGLYCAGEDDNLTPEEKPLLSKLTN--AVRNSEKAGQIDATLFLKL 141

  Fly   119 DTSLQGGRMGLRAYVCIQLGVPGGKSGCMFTPIPVELTSYEPETFGLKLLQKTVGVSPAHRP--K 181
            ::...|....|..: ..:..|...:.   ..||...|.|.|.|..|:..:.|   :|..|..  |
 Worm   142 NSITAGTTRKLPLF-AFEADVTDQEK---HKPIEWILVSEESERVGVNHIAK---LSTKHGKDGK 199

  Fly   182 TVPPMLDLAQISEASTKLQSLLDLILKYVDDVIAHKVTPDNAVGRQ---LLDLIHSVPHMTHEQF 243
            :|......|| ..|.:.||:.:|||:.|::.|....:.|:..:.::   |...:.::.....| |
 Worm   200 SVGKKHAEAQ-DAAMSMLQNRVDLIVAYLEKVQDGTLQPNFEILKEANLLAQKLKTIDRYAAE-F 262

  Fly   244 TQMFNANVRNLLLVITLSQL 263
            |..|....:.:.:...:.:|
 Worm   263 TDSFEKEEKTMTVFSLMPRL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 60/280 (21%)
csn-6NP_001255725.1 MPN 13..269 CDD:387347 59/265 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.