DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and Psmd7

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_034947.1 Gene:Psmd7 / 17463 MGIID:1351511 Length:321 Species:Mus musculus


Alignment Length:286 Identity:83/286 - (29%)
Similarity:141/286 - (49%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VRVHPVVLFQVVDAFER--RNADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEA----EL 66
            |.|||:||..|||.|.|  :..:..||:|.||||..|.|::|:|.|.||..| ||:.::    :.
Mouse     9 VVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE-DDKDDSVWFLDH 72

  Fly    67 SYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYARECNNPVHLTVDTSLQGGRMGLRA 131
            .|..:||.:.:|||:.|.:|||:.||..:..:...|:|...|.|.|.|.:.:|...:...:...|
Mouse    73 DYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEA 137

  Fly   132 YVCIQL----GVPGGKSGCMFTPIPVELTSYEPETFGLKLLQK-----TVGVSPAHRPKTVPPML 187
            |:.::.    |.|..|:   |..:..|:.:.|.|..|::.|.:     |||.........|..:.
Mouse   138 YISVEEVHDDGTPTSKT---FEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLK 199

  Fly   188 DLAQISEASTKLQSLLDLILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVR 252
            .|.         ..||| |..|::.|.:.|:..::.:..||.|:.:.:|..:.::|.:.|.....
Mouse   200 GLN---------SKLLD-IRSYLEKVASGKLPINHQIIYQLQDVFNLLPDASLQEFVKAFYLKTN 254

  Fly   253 NLLLVITLSQLIKTQLQL----NEKL 274
            :.::|:.|:.||::.:.|    |.|:
Mouse   255 DQMVVVYLASLIRSVVALHNLINNKI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 82/284 (29%)
Psmd7NP_034947.1 PLN03246 6..284 CDD:215645 83/286 (29%)
MPN_RPN7_8 7..285 CDD:163693 83/286 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..321 83/286 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D455272at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.