DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and Stambp

DIOPT Version :9

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_612540.1 Gene:Stambp / 171565 RGDID:619963 Length:424 Species:Rattus norvegicus


Alignment Length:118 Identity:27/118 - (22%)
Similarity:43/118 - (36%) Gaps:42/118 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 EPETFGLKLLQKTVGVSPAHRPKTVP----PMLDLA--------QISEASTKL---------QSL 202
            |.|...||::|:...|.|......:|    |.:|:|        |.|:.:|.|         :||
  Rat   173 ELEKERLKIVQEFGKVDPGPCGPLLPDLEKPCVDVAPSSPFSPTQTSDCNTTLRPAKPPVVDRSL 237

  Fly   203 LDLILKYVDDV-----IAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNAN 250
            ....|..:::|     :.|.|.|.|..                .:|.|:.:||
  Rat   238 KPGALSVIENVPTIEGLRHIVVPRNLC----------------SEFLQLASAN 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 27/118 (23%)
StambpNP_612540.1 Interaction with CHMP3. /evidence=ECO:0000250 1..127
USP8_dimer 8..115 CDD:401063
Interaction with STAM1. /evidence=ECO:0000250 227..231 0/3 (0%)
MPN_AMSH_like 254..424 CDD:163697 8/37 (22%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 335..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1310
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.