DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3f1 and STAMBP

DIOPT Version :10

Sequence 1:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_006454.1 Gene:STAMBP / 10617 HGNCID:16950 Length:424 Species:Homo sapiens


Alignment Length:98 Identity:27/98 - (27%)
Similarity:38/98 - (38%) Gaps:30/98 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 HSSVIHEYYARECNNPVHLTVDTSLQGGRM----------GLRAYVCIQLGVPGGKSGC-MFTPI 151
            |::|      |....||   ||.||:.|.:          |||..|     |||..  | .|..:
Human   222 HTTV------RPAKPPV---VDRSLKPGALSNSESIPTIDGLRHVV-----VPGRL--CPQFLQL 270

  Fly   152 PVELTSYEPETFGL---KLLQKTVGVSPAHRPK 181
            ....|:...||.|:   ||::....::....||
Human   271 ASANTARGVETCGILCGKLMRNEFTITHVLIPK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 27/98 (28%)
STAMBPNP_006454.1 Interaction with CHMP3. /evidence=ECO:0000269|PubMed:17146056 1..127
USP8_dimer 13..117 CDD:462647
Interaction with STAM. /evidence=ECO:0000269|PubMed:10383417 227..231 0/3 (0%)
MPN_AMSH_like 254..424 CDD:163697 16/57 (28%)
JAMM motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 335..348
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.