DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and FHL5

DIOPT Version :9

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001164278.1 Gene:FHL5 / 9457 HGNCID:17371 Length:284 Species:Homo sapiens


Alignment Length:75 Identity:23/75 - (30%)
Similarity:29/75 - (38%) Gaps:17/75 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1463 KCSHCGDELGKLCYYVGCRGAAMII--ESLLLFYHINCFKCCVCHVQL-GDGLNGTDVRVRNHKL 1524
            ||..|...:.      |..||..|.  :|.   :|..||.|..|.|.| |.|.     ..:|.::
Human   221 KCVACSKPIS------GLTGAKFICFQDSQ---WHSECFNCGKCSVSLVGKGF-----LTQNKEI 271

  Fly  1525 HCQNCYSSDD 1534
            .||.|.|..|
Human   272 FCQKCGSGMD 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823 12/36 (33%)
FHL5NP_001164278.1 LIM <5..34 CDD:351770
LIM1_FHL 37..95 CDD:188729
LIM2_FHL5 102..155 CDD:188812
LIM3_FHL 163..214 CDD:188732
LIM4_FHL 222..277 CDD:188733 19/68 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.