powered by:
Protein Alignment smash and FHL5
DIOPT Version :9
Sequence 1: | NP_001246912.1 |
Gene: | smash / 40583 |
FlyBaseID: | FBgn0263346 |
Length: | 1541 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001164278.1 |
Gene: | FHL5 / 9457 |
HGNCID: | 17371 |
Length: | 284 |
Species: | Homo sapiens |
Alignment Length: | 75 |
Identity: | 23/75 - (30%) |
Similarity: | 29/75 - (38%) |
Gaps: | 17/75 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 1463 KCSHCGDELGKLCYYVGCRGAAMII--ESLLLFYHINCFKCCVCHVQL-GDGLNGTDVRVRNHKL 1524
||..|...:. |..||..|. :|. :|..||.|..|.|.| |.|. ..:|.::
Human 221 KCVACSKPIS------GLTGAKFICFQDSQ---WHSECFNCGKCSVSLVGKGF-----LTQNKEI 271
Fly 1525 HCQNCYSSDD 1534
.||.|.|..|
Human 272 FCQKCGSGMD 281
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1704 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.