Sequence 1: | NP_001246912.1 | Gene: | smash / 40583 | FlyBaseID: | FBgn0263346 | Length: | 1541 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021334342.1 | Gene: | lims2 / 553696 | ZFINID: | ZDB-GENE-050522-56 | Length: | 378 | Species: | Danio rerio |
Alignment Length: | 214 | Identity: | 43/214 - (20%) |
---|---|---|---|
Similarity: | 74/214 - (34%) | Gaps: | 63/214 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 1365 LQEAEQRRIEQLNRRSIPASKSMGKP----------------------LPDSIIQTLTERVQSKG 1407
Fly 1408 IGDRKRFDSNGNYSQVNGNNIYQQQ-----QQQKNVTNGSSINGNSSQGQEKVLSVSGKKKCSHC 1467
Fly 1468 GDEL-GKLCYYVGCRGAAMIIESLLLFYHINCFKCCVCHVQLGD-GLNGTDVRVRNHKLHCQNCY 1530
Fly 1531 SSDDGI--------KFSCV 1541 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
smash | NP_001246912.1 | DUF4757 | 14..152 | CDD:292571 | |
LIM | <1494..1530 | CDD:278823 | 12/36 (33%) | ||
lims2 | XP_021334342.1 | LIM1_PINCH | 57..115 | CDD:188717 | 16/77 (21%) |
LIM2_PINCH | 118..169 | CDD:188718 | 15/55 (27%) | ||
LIM3_PINCH | 182..231 | CDD:188719 | 3/7 (43%) | ||
LIM4_PINCH | 237..290 | CDD:188720 | |||
LIM5_PINCH | 298..351 | CDD:188721 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |