DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and lims2

DIOPT Version :9

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:XP_021334342.1 Gene:lims2 / 553696 ZFINID:ZDB-GENE-050522-56 Length:378 Species:Danio rerio


Alignment Length:214 Identity:43/214 - (20%)
Similarity:74/214 - (34%) Gaps:63/214 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1365 LQEAEQRRIEQLNRRSIPASKSMGKP----------------------LPDSIIQTLTERVQSKG 1407
            :.|||....| |:...:..:::.|:|                      :.:::...:.||.:|..
Zfish     1 MMEAEAEAPE-LDVDGLQQNQTAGEPEVPKRSDVKVYKEFCDFYVRYNMTNALANAVCERCKSSF 64

  Fly  1408 IGDRKRFDSNGNYSQVNGNNIYQQQ-----QQQKNVTNGSSINGNSSQGQEKVLSVSGKKKCSHC 1467
            ....|..:|||        .:|.:|     |..:.:..|            ......|:|.|.|.
Zfish    65 SPTEKMVNSNG--------ELYHEQCFTCAQCFQQLIQG------------LFYEFEGRKYCEHD 109

  Fly  1468 GDEL-GKLCYYVGCRGAAMIIESLLLFYHINCFKCCVCHVQLGD-GLNGTDVRVRNHKLHCQNCY 1530
            ...| ...|:..|......:|:::...:|.:||.|.||...|.| |.    |:.....| |::|:
Zfish   110 FQMLFAPCCHQCGEFVVGRVIKAMNSSWHPDCFCCEVCEAVLADVGF----VKSGGRPL-CRSCH 169

  Fly  1531 SSDDGI--------KFSCV 1541
            |....:        |..||
Zfish   170 SRQKALSLGKHVCQKCLCV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823 12/36 (33%)
lims2XP_021334342.1 LIM1_PINCH 57..115 CDD:188717 16/77 (21%)
LIM2_PINCH 118..169 CDD:188718 15/55 (27%)
LIM3_PINCH 182..231 CDD:188719 3/7 (43%)
LIM4_PINCH 237..290 CDD:188720
LIM5_PINCH 298..351 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.