DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and Lmcd1

DIOPT Version :9

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001008562.1 Gene:Lmcd1 / 494021 RGDID:1308963 Length:365 Species:Rattus norvegicus


Alignment Length:128 Identity:32/128 - (25%)
Similarity:49/128 - (38%) Gaps:34/128 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 PGYDTSSSNAQASSPDLCEYTYEGAIQDYKQRVQRASSNGNGNANGKLIGEHIAYPTRRG----- 333
            |.||        ..|..|....|..::..::.|::..|...|      :|| :|.|.:.|     
  Rat   162 PIYD--------QDPSRCRGLVENELKAMEEFVKQYKSEALG------VGE-VALPGQGGLPKEE 211

  Fly   334 SKIEDRLSGFEVTSPSDTQEGVEKQKVDVPKVDISKRKEIFEQAKAEVSNGGAPAAPKLVFRD 396
            :|.:::..|.|.|:|  |..|        ...|.||..|..    .|:..|.|||...:|:.|
  Rat   212 NKTQEKPEGTETTAP--TTNG--------SLGDPSKEVEYV----CELCKGVAPADSPVVYAD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823
Lmcd1NP_001008562.1 PET_testin 116..203 CDD:193604 12/55 (22%)
LIM1_Testin_like 243..300 CDD:188726 7/18 (39%)
LIM 306..359 CDD:413332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.