DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and fhl2a

DIOPT Version :9

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001003732.1 Gene:fhl2a / 445277 ZFINID:ZDB-GENE-040808-49 Length:279 Species:Danio rerio


Alignment Length:96 Identity:22/96 - (22%)
Similarity:34/96 - (35%) Gaps:32/96 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1464 CSHCGDEL-GK------------LCYY-------------VGCRGAAMIIESLLLFYHINCFKCC 1502
            |.:|.:.| ||            .||.             :||....:..:.  ..:|.:||.|.
Zfish     7 CHYCKESLFGKKYVLREDNPYCVKCYESLYSNTCEECKKPIGCNSRDLSYKD--RHWHEDCFHCF 69

  Fly  1503 VCHVQLGDGLNGTDVRVRNHKLHCQNCYSSD 1533
            .|...|.|....|    ::.:|.|..|||::
Zfish    70 QCKRSLVDKPFST----KDEQLLCTECYSNE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823 10/35 (29%)
fhl2aNP_001003732.1 LIM <7..33 CDD:295319 6/25 (24%)
LIM1_FHL2 36..97 CDD:188806 15/67 (22%)
LIM2_FHL2 101..157 CDD:188810
LIM3_Fhl2 162..218 CDD:188815
LIM 221..278 CDD:295319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.