DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and PRICKLE3

DIOPT Version :10

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_006141.2 Gene:PRICKLE3 / 4007 HGNCID:6645 Length:615 Species:Homo sapiens


Alignment Length:123 Identity:31/123 - (25%)
Similarity:45/123 - (36%) Gaps:24/123 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1183 ANVPQQQQQMVLHAYHQMDTDYRKSMSDLNEFSNCLILPPTPPTKPLRAMQLNANGHGLEPDYAV 1247
            |..|::..:.:..|.|      |.||.:|...|    :|..||..|        ....|.||.:.
Human   419 ATGPEEPSRFLRGAPH------RHSMPELGLRS----VPEPPPESP--------GQPNLRPDDSA 465

  Fly  1248 STRQRQPPAPYGGSLVKIAG------APMPPRLPGQGYPIQAPTAPAYHHQSAQNLSN 1299
            ..||..|...:...||...|      ||...|...:..|.:||:...:||.:..:..|
Human   466 FGRQSTPRVSFRDPLVSEGGPRRTLSAPPAQRRRPRSPPPRAPSRRRHHHHNHHHHHN 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 <47..153 CDD:464950
PAT1 <1159..>1335 CDD:401645 31/123 (25%)
LIM <1494..1530 CDD:395333
PRICKLE3NP_006141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PET_Prickle 82..178 CDD:193602
LIM1_Prickle 186..244 CDD:188799
LIM2_Prickle 249..304 CDD:188802
LIM3_Prickle 309..367 CDD:188804
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..567 31/123 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 587..615
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.