DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and Prickle4

DIOPT Version :9

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001277266.1 Gene:Prickle4 / 381104 MGIID:2685785 Length:369 Species:Mus musculus


Alignment Length:252 Identity:46/252 - (18%)
Similarity:86/252 - (34%) Gaps:99/252 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly  1360 NNHWLLQ-----------------EAEQRRIEQLNRRSIPAS--KSMGKPLPD-----------S 1394
            |:.|.||                 ::.:|.:|.....|..|:  .|:|.|..|           :
Mouse     5 NSDWSLQQDNPIFREPDPPVYTDSDSGRRPVEDYEDTSAQAATCSSLGPPCLDINQVSNWPGFRT 69

  Fly  1395 IIQTLTERVQSKGIGDRKRFDSNGNYSQVNGN------NIYQQQQQQKNVTNG------SSINGN 1447
            ::|.|..:            ||:..|....|.      .::..|::||::..|      ..:.|.
Mouse    70 LLQQLPPQ------------DSDERYCLALGEEELAQLRLFCAQRKQKSLGQGVARLLPPKLEGY 122

  Fly  1448 SSQGQEKVL---------SVSGKKKCSHCGDELGKLCYYVGCRGAAMIIESLLLFYHINCFKCCV 1503
            :.:..:|:|         :.:|::.|.|      :.|:  .|:.....:.:|:.|||.....|..
Mouse   123 TCKKCKKLLDPGEYGVFAARAGEQSCWH------RPCF--ACQACGQGLINLIYFYHEGHLYCGR 179

  Fly  1504 CHVQL-------------------GDGLNGTDVRVRNHKLH--CQNCYSSDDGIKFS 1539
            .|.:|                   .:|       .|.|:.|  ||:|....||.:::
Mouse   180 HHAELLRPRCPACDQLIFSQRCTEAEG-------QRWHENHFCCQDCAGPLDGGRYA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823 11/56 (20%)
Prickle4NP_001277266.1 PET_OEBT 1..116 CDD:193603 22/122 (18%)
LIM1_Testin_like 124..181 CDD:188726 12/64 (19%)
LIM2_Testin_like 187..241 CDD:188727 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.