DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and Prickle3

DIOPT Version :9

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001014132.1 Gene:Prickle3 / 317380 RGDID:1359685 Length:623 Species:Rattus norvegicus


Alignment Length:331 Identity:76/331 - (22%)
Similarity:101/331 - (30%) Gaps:129/331 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   750 TSNSNENNQSTNQTSNSRNQKESSTAATSAANPVPPTTPGEQAEPYYQVPKATEPYYDAPKH-LR 813
            |:.....:.|....:.:.....:|.:||...:.........::||      |..|  :.|.| ||
  Rat   374 TAGPGRRSWSAGTVTTALTASTASFSATEVTSETASKGTCTKSEP------AAGP--EEPSHFLR 430

  Fly   814 PVPVYENVEIFYSGLEISQGSVGAP-------VGLMEPPKEKPPPPPTESPIPLDEGH-----DD 866
                                  |||       :||...|:     ||||||     ||     ||
  Rat   431 ----------------------GAPHRHSMPELGLRSAPE-----PPTESP-----GHPALHPDD 463

  Fly   867 ELDGLGNSLGHNTDTWSSDNTYETISNGTRRHLQGQPEPAQPSPPIKRMNSTKRIKKELRNKRSS 931
                       || |:...:| ..:|.......:|.|.....:||.:|           |..|| 
  Rat   464 -----------NT-TFGRQST-PRVSFRDPLVSEGGPRRTLSAPPAQR-----------RRPRS- 503

  Fly   932 FLGIENDGDLDDMETYLELTVAPPPDMAQLL--------QEERRLEKQLYIKAG-----LCDSSD 983
                                  |||......        :..||...|.:...|     .|   |
  Rat   504 ----------------------PPPRAPSCYHHHHRRRRRRRRRGSHQHHHHPGRHGHHRC---D 543

  Fly   984 TGESRDSG-VSENHSRQSSEHYTNSSEENDTQSEATPPPLPP---PPSTAQVGEVIYQNESLLAA 1044
            .|...||| .|.:.|..|||     |.|:|........||||   .|.|.| |..   .|:..:|
  Rat   544 LGSGSDSGSCSSSPSSPSSE-----SSEDDGFFLGERIPLPPHLCRPKTTQ-GTA---TETFNSA 599

  Fly  1045 QTPLLQ 1050
            ..||:|
  Rat   600 AQPLVQ 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823
Prickle3NP_001014132.1 PET_Prickle 82..178 CDD:193602
LIM1_Prickle 186..244 CDD:188799
LIM2_Prickle 249..304 CDD:188802
LIM3_Prickle 309..367 CDD:188804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.