DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and Tesl

DIOPT Version :9

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001107222.1 Gene:Tesl / 316142 RGDID:1305365 Length:406 Species:Rattus norvegicus


Alignment Length:337 Identity:62/337 - (18%)
Similarity:101/337 - (29%) Gaps:126/337 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1273 RLPGQGYP-----IQAPTAP-----------AYHHQSAQNLSNMSRNTLLALSATPKPKYADGWV 1321
            :|..:|.|     :.|.|.|           :|..........::||.:    |..|...:..|.
  Rat    69 KLKSEGMPMFKHNVMAMTNPCTAEKKFFNTGSYEWAPPVQRQELARNYM----AKEKLSLSGSWA 129

  Fly  1322 QVQQRKSYDSQQTSDAAWLAAQQQKRKSMPDYGGALYNNNHWLLQEAEQRRIEQLNRRSIPASKS 1386
            ....:|....|       |.|..|......:            |...|.|.:||..::       
  Rat   130 TQYLKKQLSKQ-------LPAHDQDPSKCHE------------LSPNEVREMEQFIKK------- 168

  Fly  1387 MGKPLPDSIIQTLTERVQSKGIGDRKRFDSNGNYSQVN--GNNIYQQQQQQKNVTNGSSINGNSS 1449
                          .:.::.|:|..|      :.|:||  |:.: |...:.:|.|:..|....|:
  Rat   169 --------------YKNEALGVGAMK------HLSEVNDQGDKV-QNPARVRNTTSALSSKEKST 212

  Fly  1450 QGQEKVLSV------------------SGKKK--------CSHCGDELGKLCY-------YVG-- 1479
            :.::...|.                  :|..|        ||.||:.|..:.|       |.|  
  Rat   213 EPKKTQYSCYCCKQPIKEGDTAIYAERAGYNKLWHPSCFICSTCGELLVHMIYFWKNGKLYCGRH 277

  Fly  1480 --------CRGAAMIIESLLLF------YHINCFKCCVC--------HVQLGDGLNGTDVRVRNH 1522
                    |.|...:|.|....      :|:..|.|..|        :|.:.|........::||
  Rat   278 YCDSEKPRCAGCDELIFSKEYTQAENQNWHLKHFSCFDCDKILAGKIYVMVNDKPVCKPCYMKNH 342

  Fly  1523 KLHCQNCYSSDD 1534
            .:.||.|.|..|
  Rat   343 AVKCQECQSVID 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823 10/43 (23%)
TeslNP_001107222.1 PET_testin 101..183 CDD:193604 19/131 (15%)
LIM1_Testin 221..278 CDD:188797 10/56 (18%)
LIM2_Testin 284..339 CDD:188800 10/54 (19%)
LIM 346..404 CDD:295319 5/9 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.