DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and Fhl3

DIOPT Version :10

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001101449.1 Gene:Fhl3 / 313582 RGDID:1307180 Length:288 Species:Rattus norvegicus


Alignment Length:91 Identity:23/91 - (25%)
Similarity:32/91 - (35%) Gaps:28/91 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1464 CSHCGDEL----------GKLC-------YYVGCRGAAMII--ESLLLFY-----HINCFKCCVC 1504
            |:.|.:.|          |..|       :...|.....:|  :|..|||     |..||:||.|
  Rat     7 CAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRC 71

  Fly  1505 HVQLGDGLNGTDVRVRNHKLHCQNCY 1530
            ...|.|    .....::.:|.|..||
  Rat    72 QRSLAD----EPFTCQDSELLCNECY 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 <47..153 CDD:464950
PAT1 <1159..>1335 CDD:401645
LIM <1494..1530 CDD:395333 11/40 (28%)
Fhl3NP_001101449.1 LIM <5..33 CDD:413332 5/25 (20%)
LIM1_FHL3 36..94 CDD:188807 18/62 (29%)
LIM2_FHL3 98..155 CDD:188811
LIM3_FHL 162..213 CDD:188732
LIM 221..284 CDD:413332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.