DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and LMCD1

DIOPT Version :10

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_055398.1 Gene:LMCD1 / 29995 HGNCID:6633 Length:365 Species:Homo sapiens


Alignment Length:63 Identity:12/63 - (19%)
Similarity:28/63 - (44%) Gaps:12/63 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YSEPPK---------LFTNSIFDTLFHRLYWSIRALQ---FKIFYKNEDMDLDEVVDKWEIGV 93
            |::|.:         |.|:|..:...:|....:.|:.   .:.||:.:|...::.:|..:|.:
Human    94 YTKPQRLDNGLKLQHLETSSTLEGNINRKAKGLNAVSNSTNETFYEADDGTQEKTMDITQINI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 <47..153 CDD:464950 10/59 (17%)
PAT1 <1159..>1335 CDD:401645
LIM <1494..1530 CDD:395333
LMCD1NP_055398.1 PET_testin 116..203 CDD:193604 7/41 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235
LIM1_Testin_like 243..300 CDD:188726
LIM 306..359 CDD:413332
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.