DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and Tesl1

DIOPT Version :9

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_001030036.2 Gene:Tesl1 / 236749 MGIID:3648288 Length:411 Species:Mus musculus


Alignment Length:293 Identity:57/293 - (19%)
Similarity:94/293 - (32%) Gaps:111/293 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1327 KSYDSQQTSDAAWLAAQQQK-----------RKSMPDYGGALYNNNHWLLQEAEQRRIEQLNRRS 1380
            |..|:..|....|:.:.|.|           ::..|..|           .|..|.|.:|| .:.
Mouse    93 KKNDAINTVTYDWIPSVQNKALARQYMQMLPKEKQPVTG-----------SEGAQYRKKQL-AKQ 145

  Fly  1381 IPA-----SKSMGKPLPD-SIIQTLTERVQSK--GIGDRKR-FDSNGNYSQVNGNNIYQQQQQQK 1436
            :||     ||..|....: ..::...|:.:|:  |:|:.|| .|.|....:|:         ...
Mouse   146 LPAHDQDPSKCHGLSYNEIKKMKQFVEKYKSEALGVGNVKRPSDMNAQGDKVH---------NPA 201

  Fly  1437 NVTNGSSINGNSSQGQEK---------------------VLSVSGKKK--------CSHCGDELG 1472
            .:.|.:::.|:..:.:|.                     ....:|..|        ||.||:.|.
Mouse   202 GIRNSTAVVGSKDKSKESKKTQYTCYCCKHPMKEGDPAIYAERAGYSKLWHPACFICSICGEILV 266

  Fly  1473 KLCY-------YVG----------CRGAAMIIESLLLF-----------YHINCFKCCVCH---- 1505
            .:.|       |.|          |.|.     ..|:|           :|:..|.|..||    
Mouse   267 DMIYFWKNGKLYCGRHYCDSEKPRCSGC-----DELIFSNEYTQAENKNWHLKHFCCIDCHNILA 326

  Fly  1506 ----VQLGDGLNGTDVRVRNHKLHCQNCYSSDD 1534
                |.|..........::||.:.||.|:::.|
Mouse   327 GKIYVMLKSKPVCKPCYMKNHAVVCQGCHNAID 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823 11/43 (26%)
Tesl1NP_001030036.2 PET_testin 101..188 CDD:193604 21/98 (21%)
LIM1_Testin 226..283 CDD:188797 10/56 (18%)
LIM2_Testin 289..344 CDD:188800 11/59 (19%)
LIM3_Testin 351..409 CDD:188803 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.