DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and FHL3

DIOPT Version :9

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_004459.2 Gene:FHL3 / 2275 HGNCID:3704 Length:280 Species:Homo sapiens


Alignment Length:93 Identity:24/93 - (25%)
Similarity:34/93 - (36%) Gaps:28/93 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1464 CSHCGDEL----------GKLC-------YYVGCRGAAMII--ESLLLFY-----HINCFKCCVC 1504
            |:.|.:.|          |..|       :...|.....:|  :|..|||     |..||:||.|
Human     7 CAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRC 71

  Fly  1505 HVQLGDGLNGTDVRVRNHKLHCQNCYSS 1532
            ...|.|    .....::.:|.|.:||.|
Human    72 QRSLAD----EPFTCQDSELLCNDCYCS 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823 11/40 (28%)
FHL3NP_004459.2 LIM <5..33 CDD:295319 5/25 (20%)
LIM1_FHL3 36..94 CDD:188807 17/61 (28%)
LIM2_FHL3 98..155 CDD:188811
LIM3_FHL 162..213 CDD:188732
LIM4_FHL3 221..276 CDD:188818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.