DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and FHL1

DIOPT Version :9

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:XP_006724806.1 Gene:FHL1 / 2273 HGNCID:3702 Length:339 Species:Homo sapiens


Alignment Length:115 Identity:31/115 - (26%)
Similarity:47/115 - (40%) Gaps:28/115 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1447 NSSQGQEKVLSVSGKKKCSHCGDEL-GK------------LCY-------YVGCR---GA-AMII 1487
            :|.....||.:::.|..|.:|.|.| ||            .|:       .|.||   || :..:
Human     6 HSGPSSYKVGTMAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEV 70

  Fly  1488 ESLLLFYHINCFKCCVCHVQLGDGLNGTDVRVRNHKLHCQNCYSSDDGIK 1537
            .....|:|..||:|..|...|.   |.|.| .:::|:.|..|.:.:|..|
Human    71 HYKNRFWHDTCFRCAKCLHPLA---NETFV-AKDNKILCNKCTTREDSPK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823 11/35 (31%)
FHL1XP_006724806.1 LIM <21..49 CDD:413332 7/27 (26%)
LIM1_FHL1 56..109 CDD:188730 17/56 (30%)
LIM2_FHL1 117..174 CDD:188808 31/115 (27%)
LIM3_FHL1 178..230 CDD:188813
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.