DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and Fhl4

DIOPT Version :9

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:NP_034344.2 Gene:Fhl4 / 14202 MGIID:1338765 Length:279 Species:Mus musculus


Alignment Length:150 Identity:31/150 - (20%)
Similarity:45/150 - (30%) Gaps:47/150 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1423 VNGNNIYQQQQQQKNVTNGSSINGNSSQGQEKVLSVSGKK-------------KCSHCGDELGK- 1473
            :.|....|:......||...|...|..|...|.:....|:             |||.|...|.. 
Mouse    13 LQGKKYVQKDGANYCVTCFDSHCANICQECHKPIGADSKEVCYKEQFWHNTCFKCSKCSQLLATE 77

  Fly  1474 ---------LC-------YYVGCRGAAMIIE----------SLLLFYHINCFKCCVCHVQLGDGL 1512
                     ||       .:..|:|....||          |:   :|.|||.|..|.    |.:
Mouse    78 TFVAWDKNILCNKCATRVTFPKCKGCLKDIEEGDHNVEYKGSI---WHKNCFVCTNCK----DII 135

  Fly  1513 NGTDVRVRNHKLHCQNCYSS 1532
            ...:...::...:|..||.:
Mouse   136 GTKNFFPKDEGFYCVTCYDA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 14..152 CDD:292571
LIM <1494..1530 CDD:278823 8/35 (23%)
Fhl4NP_034344.2 LIM <4..32 CDD:295319 4/18 (22%)
LIM 39..92 CDD:295319 10/52 (19%)
LIM2_FHL1 100..157 CDD:188808 15/62 (24%)
LIM3_FHL1 161..213 CDD:188813
LIM4_FHL1 216..279 CDD:188734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.