DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smash and Tes

DIOPT Version :10

Sequence 1:NP_001246912.1 Gene:smash / 40583 FlyBaseID:FBgn0263346 Length:1541 Species:Drosophila melanogaster
Sequence 2:XP_061515856.1 Gene:Tes / 1270791 VectorBaseID:AGAMI1_013653 Length:576 Species:Anopheles gambiae


Alignment Length:95 Identity:25/95 - (26%)
Similarity:35/95 - (36%) Gaps:32/95 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1463 KCSHCGDELGKLCY-------YVGCRGAAMI-------IESLLL----------FYHINCFKCCV 1503
            ||:.||:.|..|.|       |.|...|||:       .:.|:.          .:|:..|.|..
Mosquito   420 KCNRCGELLADLVYFYHGGAVYCGRDLAAMLKIPRCAACDELIFTKEYTAAEGATFHVRHFCCYH 484

  Fly  1504 CHVQLGDG-LNGTD--VRVRNHKLHCQNCY 1530
            |     || |.|..  :..|:.:..|..||
Mosquito   485 C-----DGPLAGQQYVMDERSAQPLCLPCY 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smashNP_001246912.1 DUF4757 <47..153 CDD:464950
PAT1 <1159..>1335 CDD:401645
LIM <1494..1530 CDD:395333 10/38 (26%)
TesXP_061515856.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.