DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spartin and AT3G51250

DIOPT Version :9

Sequence 1:NP_001246910.1 Gene:spartin / 40582 FlyBaseID:FBgn0037265 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_190693.1 Gene:AT3G51250 / 824288 AraportID:AT3G51250 Length:463 Species:Arabidopsis thaliana


Alignment Length:495 Identity:108/495 - (21%)
Similarity:175/495 - (35%) Gaps:143/495 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 QSIDDSAVEATEESRAEMDTKRPPL----LAENPSTQYGIA----NASGAPKTYRELAAGLRELL 158
            |||.|:...:|....|......|.|    |..|....:|.|    :.|..|:...|:      |:
plant    21 QSIPDNPFASTNPYVASSPYLYPSLSSHNLGPNLFPDHGDASNDQSPSAPPQATEEV------LI 79

  Fly   159 AVRDAKV-LLDELFRAQVKMYRIE-ASGSVT---TISGSSTMSLVMCTVGG--KW---------K 207
            .|..|.: |:|       |.|.:| |.|..|   .|.|.:.:: |:..||.  :|         |
plant    80 RVPGAILNLID-------KSYSVELACGDFTIVRIIQGQNIVA-VLANVGNEIQWPLTKNEVAAK 136

  Fly   208 YLSGIYFIQCSMPNEGTAGIWLYPLVPSITNCYQTEYGAFIFPDMECQQPGNA----------FG 262
            .....||.....|.|...|                 .|:    |.:.:|...:          :|
plant   137 VDGSHYFFSIHPPKEKGQG-----------------SGS----DSDDEQGQKSKSKSDDEILNYG 180

  Fly   263 LMLTKEGQTSRTEDELEDLQQFFLDLL---------------EAVLAGTVVQLKSPTSQRAGLAS 312
            |.:..:||    |:.|..|.|...|..               |.||..:||...|| .:..|...
plant   181 LTIASKGQ----ENVLLVLDQVLRDYSCFTEQRMSEKAKETGEEVLGNSVVADTSP-EELKGERK 240

  Fly   313 DTVSG---------SEQVSRHIVSAADFIAS---NLVRG----AEKTGGFMLRSTPYIISKMTPA 361
            |.|.|         :..|..:..|.|..|||   .|:||    .:.|...:.:....:.::::.|
plant   241 DVVEGQCAAYWTTLAPNVEDYTHSTAKMIASGSGKLIRGILWCGDVTVERLKKGNEVMKNRLSRA 305

  Fly   362 SMDAQVPSSVQTSVEVAQKVTHAAAGM-TGWIAGKVG-----TASMAVGRYLAPHIQEQGSKLLQ 420
            ..:..|.......::..::||.....: ||.::|.|.     |.|||            .||..:
plant   306 EKEKDVSPETLRRIKRVKRVTQMTEKVATGVLSGVVKVSGFITGSMA------------NSKAGK 358

  Fly   421 KGFGYDTSEANSTMEGAMTIAAGAVEGVSTVFDGLETSAKILGSSLSENSVKIIEHKYGQQTGNL 485
            |.||        .:.|.:.:|  :::|.|.:.|.:|.:.|.:.|:.|..:.:::.|:||.:....
plant   359 KLFG--------LLPGEIVLA--SLDGFSKICDAVEVAGKNVMSTSSTVTTELVNHRYGTKAAEA 413

  Fly   486 ASGTFDTVGNVFVVS----------QNVNYITPKGIAKKM 515
            .:...|..|:.|..:          ...|.|.|..:||.:
plant   414 TNEGLDAAGHAFGTAWVAFKIRKAFNPKNVIKPSSLAKSV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spartinNP_001246910.1 MIT_spastin 15..97 CDD:239142
Senescence 325..511 CDD:284359 44/208 (21%)
AT3G51250NP_190693.1 Senescence 269..437 CDD:399715 39/189 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21068
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.