DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spartin and AT3G21600

DIOPT Version :10

Sequence 1:NP_649485.1 Gene:spartin / 40582 FlyBaseID:FBgn0037265 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_188797.1 Gene:AT3G21600 / 821714 AraportID:AT3G21600 Length:374 Species:Arabidopsis thaliana


Alignment Length:204 Identity:30/204 - (14%)
Similarity:79/204 - (38%) Gaps:37/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 LASDTVSGSEQVSRHIVSAADFIASNLVRGAEKTGGFMLRSTPYIISKMTPA----------SMD 364
            :|.....|:..:.|.|.|.::..::.:.:|.:           .:|:|...:          |..
plant   174 VAKAIAGGTGHIIRGIFSLSNAYSNQVHKGGD-----------IMITKAEESQRNGSYNNGNSSG 227

  Fly   365 AQVPSSVQTSVEVAQKVTHAAAGMTGWIAGKVGTASMAVGRYLAPHIQEQGSKLLQKGFGYDTSE 429
            .:..:.:.|.::..:|::.|...::..:....|..|   |..:.|.::.      :.|..:    
plant   228 NEKKNGINTHLQRVRKLSKATENLSKTMLNGAGVVS---GSVMVPMMKS------KPGMAF---- 279

  Fly   430 ANSTMEGAMTIAAGAVEGVSTVFDGLETSAKILGSSLSENSVKIIEHKYGQQTGNLASGTFDTVG 494
             .|.:.|.:.:|  :::.::.:.|..|.:.:...|:.|..:.:::..::|...|........|.|
plant   280 -FSMVPGEVLLA--SLDALNKILDATEAAERQTLSATSRAATRMVSERFGDNAGEATGDVLATAG 341

  Fly   495 NVFVVSQNV 503
            :....:.||
plant   342 HAAGTAWNV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spartinNP_649485.1 MIT_spastin 15..97 CDD:239142
Senescence 325..517 CDD:462037 27/189 (14%)
AT3G21600NP_188797.1 Senescence 176..371 CDD:462037 29/202 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.