DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spartin and AT3G21590

DIOPT Version :9

Sequence 1:NP_001246910.1 Gene:spartin / 40582 FlyBaseID:FBgn0037265 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001326819.1 Gene:AT3G21590 / 821713 AraportID:AT3G21590 Length:218 Species:Arabidopsis thaliana


Alignment Length:142 Identity:25/142 - (17%)
Similarity:55/142 - (38%) Gaps:32/142 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 NAFGLMLTKEGQTSRTEDELEDLQQFFLDLLEAVLAGTVVQL----------KSPTSQRAGLASD 313
            |::...:.:||..:..::|               .:|.:.|:          |:..::....|..
plant    88 NSYSKKIHEEGTIAEEDEE---------------RSGDISQIDGGGNNETNKKNKLNKNLQRAEK 137

  Fly   314 TVSGSEQVSRHIVSAADFIASNLVRGA--EKTGGFMLRSTPYIISKMTPASMDAQVPSSVQTSVE 376
            ....||.:....:...|.::|:::...  .|.|..:|.:.|   .::..||:|:.  .::..:.|
plant   138 LWKVSEAIGMAALEGGDLVSSSMIAPVVKSKLGKALLSTAP---GEVILASLDSF--HNIIGAAE 197

  Fly   377 VAQKVTHAAAGM 388
            .|:..||.|..|
plant   198 AAEIQTHYATSM 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spartinNP_001246910.1 MIT_spastin 15..97 CDD:239142
Senescence 325..511 CDD:284359 15/66 (23%)
AT3G21590NP_001326819.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21068
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.