DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spartin and ERD7

DIOPT Version :9

Sequence 1:NP_001246910.1 Gene:spartin / 40582 FlyBaseID:FBgn0037265 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_179374.1 Gene:ERD7 / 816293 AraportID:AT2G17840 Length:452 Species:Arabidopsis thaliana


Alignment Length:459 Identity:86/459 - (18%)
Similarity:165/459 - (35%) Gaps:144/459 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DTKRPPLLAENPSTQYGIANASGA-----PKTYR-ELAAGLRELLAVRDAKVLLDELFRAQVKMY 178
            :|...|:.|...:|:..|...|||     .|:|. |||.|..|::.:                  
plant    55 ETSSIPVSAPPAATEEVILKISGAILHLIDKSYSVELACGDLEIIRI------------------ 101

  Fly   179 RIEASGSVTTISGSSTMSLVMCTVGGKWKYLSGIYFIQCSMPNEGTAGIWLYPLVPSITNCYQTE 243
                      :.|.:.:: |:.:|..:         ||             :||... .|..:.:
plant   102 ----------VQGENVVA-VLASVSDE---------IQ-------------WPLTKD-ENSVKVD 132

  Fly   244 YGAFIFP---------DMECQQPGNA---------FGLMLTKEGQTS---RTEDELEDLQQFFLD 287
            ...:.|.         |...::.|:.         :||.:..:||..   ..|..|||...|.:.
plant   133 ESHYFFTLRPTKEISHDSSDEEDGDGGKNTNEMLNYGLTIASKGQEHLLVELEKILEDYSSFSVQ 197

  Fly   288 LL--------EAVLAGTVVQLKSP---TSQR----------------------AGLASDTV-SGS 318
            .:        |.||..||.:..||   |.:|                      :|.|:..: :||
plant   198 EVSEEAKEAGEKVLDVTVARETSPVELTGERKEIVERQCSAYWTTLAPNVEDYSGKAAKLIATGS 262

  Fly   319 EQVSRHIVSAADFIASNLVRGAEKTGGFMLRSTPYIISKMTPASMDAQVPSSVQTSVEVAQKVTH 383
            ..:.:.|:...|.....|:.|    .|||.|       :::.|..:::|.......:...:::|.
plant   263 GHLIKGILWCGDVTMDRLIWG----NGFMKR-------RLSKAEKESEVHPDTLKRIRRVKRMTK 316

  Fly   384 AAAGMTGWIAGKVGTASMAVGRYLAPHIQEQGSKLLQKGFGYDTSEANSTMEGAMTIAAGAVEGV 448
                ||..:|..:.:..:.|..:....:  ..:|:.:|.|        |.:.|.:.:|  :::|.
plant   317 ----MTESVANSILSGVLKVSGFFTSSV--ANTKVGKKFF--------SLLPGEVILA--SLDGF 365

  Fly   449 STVFDGLETSAKILGSSLSENSVKIIEHKYGQQTGNLASGTFD----TVGNVFVVSQNVNYITPK 509
            :.|.|.:|.:.:.:.|:.|..:.::::||||.:.....:...|    .:|..:|..:....|.||
plant   366 NKVCDAVEVAGRNVMSTSSTVTTELVDHKYGGKAAEATNEGLDAAGYALGTAWVAFKIRKAINPK 430

  Fly   510 GIAK 513
            .:.|
plant   431 SVLK 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spartinNP_001246910.1 MIT_spastin 15..97 CDD:239142
Senescence 325..511 CDD:284359 37/189 (20%)
ERD7NP_179374.1 Senescence 258..426 CDD:399715 36/194 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21068
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.