DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spartin and spartb

DIOPT Version :9

Sequence 1:NP_001246910.1 Gene:spartin / 40582 FlyBaseID:FBgn0037265 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001038916.1 Gene:spartb / 751741 ZFINID:ZDB-GENE-060825-146 Length:269 Species:Danio rerio


Alignment Length:292 Identity:64/292 - (21%)
Similarity:99/292 - (33%) Gaps:96/292 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 ECQQPGNAFGLMLTKEGQTSRTEDELEDLQQFFLDLLEAVLAGTVVQLKSPTSQRAGLASDTVSG 317
            ||...|       ..|.:....|:.|:..||....||.|:         |..||    ..:.|..
Zfish    26 ECINKG-------LNEDEAGHKEEALKLYQQGRQHLLRAI---------SVPSQ----GVECVGP 70

  Fly   318 SEQVSRHIVSAADFIASNLVRGAEKTGGFMLRSTPYIISKMTPASMDAQVPSSVQTSVEVAQKV- 381
            |.:.:|.:........||:             :|...|.:.|||      |:.|......|||: 
Zfish    71 SWESARQMQHKMQETLSNI-------------TTRLAILETTPA------PNEVSNGTAAAQKLY 116

  Fly   382 --------THAAAGMTGWIAGKVGTASMAVGRYLAPHIQEQGSKLLQKGFGYDTSEANSTMEGAM 438
                    .......|  |.|:|..||   |...:|.:|.  :.|.::...|....|    :|.:
Zfish   117 PEVPKVMPQRPTPPQT--INGRVAGAS---GGQTSPTVQP--NILCEQPPAYTPQAA----DGHL 170

  Fly   439 TIAAGAVEG----VSTVFDGLETSAKILGSSLSENSVKIIEHKYGQQTGNLASGTFDTVGNVFVV 499
            ||:.|...|    |...|....:::...||||.|:         |::              :|.:
Zfish   171 TISYGTDSGELPVVGDEFYSQTSNSTPAGSSLGED---------GEE--------------LFFL 212

  Fly   500 SQNVN--YITPKGIAK--------KMVKRTGE 521
            .|.|.  ::||:|...        ::||.|.|
Zfish   213 PQGVQIFFVTPEGHVSAPSYPGYLRIVKFTSE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spartinNP_001246910.1 MIT_spastin 15..97 CDD:239142
Senescence 325..511 CDD:284359 42/200 (21%)
spartbNP_001038916.1 MIT_spastin 17..96 CDD:239142 20/102 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587262
Domainoid 1 1.000 105 1.000 Domainoid score I6576
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I4290
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290487at33208
OrthoFinder 1 1.000 - - FOG0006009
OrthoInspector 1 1.000 - - otm24583
orthoMCL 1 0.900 - - OOG6_107088
Panther 1 1.100 - - LDO PTHR21068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.