DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rpk and Asic5

DIOPT Version :10

Sequence 1:NP_001246909.1 Gene:rpk / 40580 FlyBaseID:FBgn0022981 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_067345.1 Gene:Asic5 / 58170 MGIID:1929259 Length:495 Species:Mus musculus


Alignment Length:65 Identity:21/65 - (32%)
Similarity:32/65 - (49%) Gaps:9/65 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LGMTT--ENVRTDFKDDSEDTSSQSPQSTSSMEVTSSQQIVAKVRN----RVEYYIVNPKTQAPA 140
            |..||  |.|..|.|..|:..|.|: .:|||.||.|..::  ::||    ::....:|.:...||
Mouse    89 LNHTTRLEIVHEDVKMGSDGESDQA-SATSSDEVHSPVRV--RLRNNPGRKISTEDINKRLSLPA 150

  Fly   141  140
            Mouse   151  150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rpkNP_001246909.1 ASC 39..552 CDD:459966 21/65 (32%)
Asic5NP_067345.1 Binds the plasma membrane and stabilizes the channel in the closed state. /evidence=ECO:0000250|UniProtKB:Q9R0W5 1..30
ASC 41..466 CDD:459966 21/65 (32%)
GAS motif, ion selectivity filter. /evidence=ECO:0000250|UniProtKB:P78348 454..456
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.