DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rpk and Gr59e

DIOPT Version :9

Sequence 1:NP_001246909.1 Gene:rpk / 40580 FlyBaseID:FBgn0022981 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:295 Identity:57/295 - (19%)
Similarity:99/295 - (33%) Gaps:93/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ERIFWLFVFLISIYGCSTLIQ------SAYTKWTETPV-----------IVSFAEKSTPVWNIPF 107
            :|...|....:..:|...|:.      ..:|.|:...|           ::.:|:....:| :..
  Fly   119 QRTLHLMATTLVFHGLCVLVDVVNYDFEFWTTWSSNSVYNLPGLMMSLGVLQYAQPVHFLW-LVM 182

  Fly   108 PAVTVCSETKRVLKQKGKETTYAD--LYSQFSEDMRASRVFRPENVSALEMEEFRTLLHVCNTQI 170
            ..:.:|.:..::|::..:.:|..|  ..|.|:..:.|.      ..|||.:||.|   :.||  :
  Fly   183 DQMRMCLKELKLLQRPPQGSTKLDACYESAFAVLVDAG------GGSALMIEEMR---YTCN--L 236

  Fly   171 IEEDIPLIAGDDLDYFDVLQRMLPQFDRYFFYCRWLSRFGECE------TFFRKTLTEEGICYTF 229
            ||:              |..:.|.:|..|.......|....|.      .||...|.||.:...:
  Fly   237 IEQ--------------VHSQFLLRFGLYLVLNLLNSLVSICVELYLIFNFFETPLWEESVLLVY 287

  Fly   230 NGLRATEIYRDDTYQYQHSG---------EPL------------EMENISS--QHT--AWTLETG 269
            ..|          :...|.|         |.:            |:|..||  |.|  .:.|:..
  Fly   288 RLL----------WLAMHGGRIWFILSVNEQILEQKCNLCQLLNELEVCSSRLQRTINRFLLQLQ 342

  Fly   270 YALDSDVE-----TFPARVLSAGARSGIFLALQSF 299
            .::|..:|     |...|  |.|...|:.:|:..|
  Fly   343 RSIDQPLEACGIVTLDTR--SLGGFIGVLMAIVIF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rpkNP_001246909.1 ASC 39..552 CDD:279230 57/295 (19%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 57/295 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.