DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rpk and ppk23

DIOPT Version :9

Sequence 1:NP_001246909.1 Gene:rpk / 40580 FlyBaseID:FBgn0022981 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001097011.1 Gene:ppk23 / 32731 FlyBaseID:FBgn0030844 Length:591 Species:Drosophila melanogaster


Alignment Length:586 Identity:121/586 - (20%)
Similarity:203/586 - (34%) Gaps:184/586 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EYCRNTSIHGVQYLGEQERPFRERIFWLFVFLISIYGCSTLIQSAYTKWTETPVIVSFAEKSTPV 102
            |:.:|:::|||:|:.|..||..|:..|.....|.......:|.|.:.|:...|.|... :.....
  Fly    33 EFFQNSTLHGVRYIAESGRPIGEKFMWFCFTSIGAVTALVIIMSLWEKFQTNPTITGL-DTDFHN 96

  Fly   103 WNIPFPAVTVCSETKRVLKQKGKETTYADLYSQFSE-DMRASRVFRP--ENVSALEMEEFRTLLH 164
            .|:.||...||.|.     ....:.||..:|:..:. |...::::.|  ..:::|..|..|    
  Fly    97 QNVVFPTTVVCPEA-----AFDHDKTYEKVYNTLANYDEAQAQMYTPFLRILTSLNFENVR---- 152

  Fly   165 VCNTQIIEEDIPLIAGDDLDYFDVLQRMLP-------QFDRY------FFYCRWLSRFGECETFF 216
              :.:::.:.||             |.:|.       .|:.:      |..|::......|...|
  Fly   153 --DAKVLSQSIP-------------QNLLDAHTIREWAFEGHIDCKNVFVSCKYRDEDIPCCDHF 202

  Fly   217 RKTLTEEGICYTFNGLRATEIYRDDTYQYQHSGEPLEMENISSQHTAWTLETGYALDSDVETFPA 281
            ....||.|.||.||.              :....|.|.....:.|..:..:..:||         
  Fly   203 EPIYTEHGFCYAFNS--------------RFKSTPTEDVKTGAPHDLYETDKKWAL--------- 244

  Fly   282 RVLSAGARSGIFLAL------QSFKQEVDYACRGPVQGFKVGKFENVLLHAPDDVPQVSKQFVRI 340
             .....:.|.||:..      ..|..::|::                       .||:       
  Fly   245 -FFIPNSTSRIFIFSNEEYFGSDFNAQIDWS-----------------------EPQL------- 278

  Fly   341 PMGKEVLIAVKPNMIT-----MSSGIAEYHPVRRQCFLSHERSLRFF-KVYTESNCQLECLANFT 399
               .||.|:.|....|     :|.|       :|:|..|.|..|.:| ..||.|:|..:|..|..
  Fly   279 ---VEVRISKKNTYTTDDARQLSIG-------QRKCIFSDEVKLNYFPDAYTFSSCMKQCRMNKA 333

  Fly   400 LTKCGC--------------------------VKFSMPRNVDMPVCGEDKIHCYDRAERELLVRE 438
            :..|.|                          :.:..|: .::|:|......|.|         |
  Fly   334 IKLCKCNPPFYKPIRELSCVINIFTNLIAYILLLYLTPK-ANVPMCSIKDFDCLD---------E 388

  Fly   439 FKRVKALNAGRENSRSVESACNCMPACTSLVYNTEISQANFDLEEMLVAEGDTEFLKEYPGSQMS 503
            ||         .|..:::....|..:|:..|:|.:                  :.:|.....:..
  Fly   389 FK---------SNITNIKDCLQCELSCSKTVFNID------------------KLIKMSDRPESL 426

  Fly   504 RLSIYFKQSQFITSKRSELYGMTEFLANCGGIFGLFMGFSILSLVEMIYHFTLR----LFTNLKR 564
            .:.:.|.....|..||..|:|..:.|.:.|||..||:|||:||.||:||:||||    ::.|.:.
  Fly   427 GVLVEFLTWPIIRYKREVLFGWVDLLVSFGGIASLFLGFSLLSGVEIIYYFTLRACCMVYKNRQE 491

  Fly   565 L 565
            |
  Fly   492 L 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rpkNP_001246909.1 ASC 39..552 CDD:279230 112/566 (20%)
ppk23NP_001097011.1 ASC 34..476 CDD:279230 113/567 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.