powered by:
Protein Alignment rpk and LOC103910008
DIOPT Version :9
Sequence 1: | NP_001246909.1 |
Gene: | rpk / 40580 |
FlyBaseID: | FBgn0022981 |
Length: | 568 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_009296668.1 |
Gene: | LOC103910008 / 103910008 |
-ID: | - |
Length: | 99 |
Species: | Danio rerio |
Alignment Length: | 31 |
Identity: | 10/31 - (32%) |
Similarity: | 22/31 - (70%) |
Gaps: | 0/31 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 537 GLFMGFSILSLVEMIYHFTLRLFTNLKRLVK 567
|||:|.|:|:::|::.:....:...|:||::
Zfish 2 GLFIGASVLTILEILDYVYEVIKHRLERLLR 32
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
rpk | NP_001246909.1 |
ASC |
39..552 |
CDD:279230 |
7/14 (50%) |
LOC103910008 | XP_009296668.1 |
ASC |
<1..32 |
CDD:295594 |
10/29 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D303969at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.