DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED31 and SOH1

DIOPT Version :9

Sequence 1:NP_001246908.1 Gene:MED31 / 40577 FlyBaseID:FBgn0037262 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_011388.1 Gene:SOH1 / 852750 SGDID:S000003095 Length:127 Species:Saccharomyces cerevisiae


Alignment Length:64 Identity:30/64 - (46%)
Similarity:46/64 - (71%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RWQIELEFVQCLSNPNYLNF-LAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLL 83
            |:::||||:|.|:|..|:.: |.|:..:|..:|.||||||:||..|.|::.::||.||:.|.||
Yeast    22 RFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLL 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED31NP_001246908.1 Med31 19..112 CDD:283352 30/64 (47%)
SOH1NP_011388.1 SOH1 2..127 CDD:227420 30/64 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346672
Domainoid 1 1.000 69 1.000 Domainoid score I2303
eggNOG 1 0.900 - - E1_COG5088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005177
OrthoInspector 1 1.000 - - oto99786
orthoMCL 1 0.900 - - OOG6_103162
Panther 1 1.100 - - LDO PTHR13186
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R705
SonicParanoid 1 1.000 - - X3693
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.