powered by:
Protein Alignment MED31 and SOH1
DIOPT Version :9
Sequence 1: | NP_001246908.1 |
Gene: | MED31 / 40577 |
FlyBaseID: | FBgn0037262 |
Length: | 204 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011388.1 |
Gene: | SOH1 / 852750 |
SGDID: | S000003095 |
Length: | 127 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 64 |
Identity: | 30/64 - (46%) |
Similarity: | 46/64 - (71%) |
Gaps: | 1/64 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 RWQIELEFVQCLSNPNYLNF-LAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLL 83
|:::||||:|.|:|..|:.: |.|:..:|..:|.||||||:||..|.|::.::||.||:.|.||
Yeast 22 RFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWCNPPYSQCIVYPNCLFILKLL 85
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
MED31 | NP_001246908.1 |
Med31 |
19..112 |
CDD:283352 |
30/64 (47%) |
SOH1 | NP_011388.1 |
SOH1 |
2..127 |
CDD:227420 |
30/64 (47%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157346672 |
Domainoid |
1 |
1.000 |
69 |
1.000 |
Domainoid score |
I2303 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5088 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005177 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto99786 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103162 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR13186 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R705 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3693 |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
11 | 10.730 |
|
Return to query results.
Submit another query.