DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED31 and MED31

DIOPT Version :9

Sequence 1:NP_001246908.1 Gene:MED31 / 40577 FlyBaseID:FBgn0037262 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001190342.1 Gene:MED31 / 832113 AraportID:AT5G19910 Length:226 Species:Arabidopsis thaliana


Alignment Length:167 Identity:59/167 - (35%)
Similarity:94/167 - (56%) Gaps:11/167 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLL 83
            ::|:.:||||:|||:||.|:::|||..:|:|::||.||||||||:.|:|.|::|||.|||||:||
plant    29 RQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELL 93

  Fly    84 QYEHFRREIVN--SQCCKFIDDQAILQWQHY---TRKRIKLIENVTAAQQQQQQLQQQQQQANG- 142
            |..:||..:.:  ::..|.:.....  |..:   ...|:.|::|:......:||....:...|. 
plant    94 QNPNFRTAMAHPANKWFKMLGYWCF--WNVFWGLVEFRVSLVQNLAYELAHRQQFYYWKNYRNNR 156

  Fly   143 ---MEAATGGESAAPTPNVNGSASTADSQQTSSALQP 176
               :......|...|.|.|..|.|...:...::||.|
plant   157 LKHILPRPLPEPVPPQPPVAPSTSLPPAPSATAALSP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED31NP_001246908.1 Med31 19..112 CDD:283352 44/94 (47%)
MED31NP_001190342.1 Med31 29..119 CDD:283352 43/91 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 110 1.000 Domainoid score I2113
eggNOG 1 0.900 - - E1_COG5088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I2029
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1480492at2759
OrthoFinder 1 1.000 - - FOG0005177
OrthoInspector 1 1.000 - - oto4253
orthoMCL 1 0.900 - - OOG6_103162
Panther 1 1.100 - - LDO PTHR13186
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3693
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.