DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED31 and MED31

DIOPT Version :9

Sequence 1:NP_001246908.1 Gene:MED31 / 40577 FlyBaseID:FBgn0037262 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_057144.1 Gene:MED31 / 51003 HGNCID:24260 Length:131 Species:Homo sapiens


Alignment Length:132 Identity:85/132 - (64%)
Similarity:108/132 - (81%) Gaps:11/132 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AIESEELQKR-RWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYP 74
            |:|:::...| |:|:||||||||:||||||||||||:|||::|:||||||.|||:|:|||||.||
Human     6 AMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYP 70

  Fly    75 MCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQ 139
            .||:.|:||||||||:|:||:||.||||:|.||.||||:|||::|          ||.|.:||||
Human    71 QCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRL----------QQALAEQQQQ 125

  Fly   140 AN 141
            .|
Human   126 NN 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED31NP_001246908.1 Med31 19..112 CDD:283352 69/93 (74%)
MED31NP_057144.1 Med31 15..108 CDD:398993 70/93 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160116
Domainoid 1 1.000 168 1.000 Domainoid score I3849
eggNOG 1 0.900 - - E1_COG5088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I3961
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1480492at2759
OrthoFinder 1 1.000 - - FOG0005177
OrthoInspector 1 1.000 - - oto90354
orthoMCL 1 0.900 - - OOG6_103162
Panther 1 1.100 - - LDO PTHR13186
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R705
SonicParanoid 1 1.000 - - X3693
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.