DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED31 and med31

DIOPT Version :9

Sequence 1:NP_001246908.1 Gene:MED31 / 40577 FlyBaseID:FBgn0037262 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001004826.2 Gene:med31 / 448081 XenbaseID:XB-GENE-951034 Length:128 Species:Xenopus tropicalis


Alignment Length:131 Identity:86/131 - (65%)
Similarity:109/131 - (83%) Gaps:10/131 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPM 75
            |:|::|.|:.|:|:||||||||:||||||||||||:|||:||:||||||.|||:|:|||||.||.
 Frog     4 AMETDEQQRIRFQLELEFVQCLANPNYLNFLAQRGYFKDKSFVNYLKYLLYWKDPEYAKYLKYPQ 68

  Fly    76 CLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQA 140
            ||:.|:||||||||:|:||:||.||||:|.||.||||:|||:::          ||.|.:||||.
 Frog    69 CLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRM----------QQALAEQQQQN 123

  Fly   141 N 141
            |
 Frog   124 N 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED31NP_001246908.1 Med31 19..112 CDD:283352 69/92 (75%)
med31NP_001004826.2 Med31 12..105 CDD:283352 69/92 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 169 1.000 Domainoid score I3768
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3754
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1480492at2759
OrthoFinder 1 1.000 - - FOG0005177
OrthoInspector 1 1.000 - - oto104160
Panther 1 1.100 - - LDO PTHR13186
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R705
SonicParanoid 1 1.000 - - X3693
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.