DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED31 and med31

DIOPT Version :9

Sequence 1:NP_001246908.1 Gene:MED31 / 40577 FlyBaseID:FBgn0037262 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001002417.2 Gene:med31 / 436690 ZFINID:ZDB-GENE-040718-114 Length:136 Species:Danio rerio


Alignment Length:130 Identity:82/130 - (63%)
Similarity:107/130 - (82%) Gaps:2/130 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMC 76
            :|::|..::|:|:||||||||:||||||||||||:.:::.|:||||||.|||||:|||:|.||.|
Zfish     5 METDEQARQRFQLELEFVQCLANPNYLNFLAQRGYLREKPFVNYLKYLLYWKEPEYAKFLKYPHC 69

  Fly    77 LYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQAN 141
            |:.|:||||||||:|:||:||.||||:|.||.||||:|||.:|.:  ..|:|||||..|....||
Zfish    70 LHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRTRLQQ--ALAEQQQQQQPQAPSHAN 132

  Fly   142  141
            Zfish   133  132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED31NP_001246908.1 Med31 19..112 CDD:283352 65/92 (71%)
med31NP_001002417.2 Med31 12..105 CDD:283352 65/92 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..136 9/16 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596439
Domainoid 1 1.000 161 1.000 Domainoid score I4003
eggNOG 1 0.900 - - E1_COG5088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 184 1.000 Inparanoid score I3947
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1480492at2759
OrthoFinder 1 1.000 - - FOG0005177
OrthoInspector 1 1.000 - - oto41678
orthoMCL 1 0.900 - - OOG6_103162
Panther 1 1.100 - - LDO PTHR13186
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R705
SonicParanoid 1 1.000 - - X3693
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.