DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED31 and Med31

DIOPT Version :9

Sequence 1:NP_001246908.1 Gene:MED31 / 40577 FlyBaseID:FBgn0037262 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001129285.1 Gene:Med31 / 287475 RGDID:1309457 Length:131 Species:Rattus norvegicus


Alignment Length:130 Identity:85/130 - (65%)
Similarity:107/130 - (82%) Gaps:11/130 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AIESEELQKR-RWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYP 74
            |:|:::...| |:|:||||||||:||||||||||||:|||::|:||||||.|||||:|||||.||
  Rat     6 AMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKEPEYAKYLKYP 70

  Fly    75 MCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQ 139
            .||:.|:||||||||:|:||:||.||||:|.||.||||:|||::|          ||.|.:||||
  Rat    71 QCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRL----------QQALAEQQQQ 125

  Fly   140  139
              Rat   126  125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED31NP_001246908.1 Med31 19..112 CDD:283352 70/93 (75%)
Med31NP_001129285.1 Med31 15..108 CDD:398993 70/92 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354183
Domainoid 1 1.000 169 1.000 Domainoid score I3715
eggNOG 1 0.900 - - E1_COG5088
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 184 1.000 Inparanoid score I3853
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1480492at2759
OrthoFinder 1 1.000 - - FOG0005177
OrthoInspector 1 1.000 - - oto97470
orthoMCL 1 0.900 - - OOG6_103162
Panther 1 1.100 - - LDO PTHR13186
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3693
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.