DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9775 and Chtopl1

DIOPT Version :9

Sequence 1:NP_001262257.1 Gene:CG9775 / 40576 FlyBaseID:FBgn0037261 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_003749859.2 Gene:Chtopl1 / 500378 RGDID:1584868 Length:249 Species:Rattus norvegicus


Alignment Length:420 Identity:95/420 - (22%)
Similarity:126/420 - (30%) Gaps:206/420 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TGISLNERFTQM-QSKQPPQGRGRSRSRSRSRRIVSSGAGNQGMSAVNSRLLNEFKRLHTVQTAL 66
            |.:|||||||.| ::|||.....|:..:.:          .|..||.|.||..:.:...:||.||
  Rat    15 TKMSLNERFTNMLKNKQPMPVNIRASMQQQ----------QQLASARNRRLAQQMENRPSVQAAL 69

  Fly    67 KLKRRSLRTTAVSGRGPRVAGVKSLRLAPNGKPIRSNNVTRVATMRADLVASGNAARNRRSGSSM 131
            |||::||:        .|:.  ||...|..|:||                  |..||....|.|:
  Rat    70 KLKQKSLK--------QRLG--KSNIQARLGRPI------------------GALARGAIGGRSL 106

  Fly   132 ----RNVPATNGGGGGLRQRLGQRRPSVGGAAERVERRQRQQQQAPRGRSRSQSRSRHPQIQRVD 192
                |.:|.     ||||          ||.|.|.                            :.
  Rat   107 PIIQRGLPR-----GGLR----------GGRATRT----------------------------LL 128

  Fly   193 RARSQSRGRSIGRSQSRNRDRSAQGRVPVKQRLSVKHRLGVRTGQRNNQAKIPPQRRAPSQIRGV 257
            |.....||:::.|.          ||       :|..|:|:|.|                   ||
  Rat   129 RGGMSLRGQNLLRG----------GR-------AVAPRMGLRRG-------------------GV 157

  Fly   258 AGGRVEKRRSAQISQKKGVSASIAGRQGRPRRRSVARNAASSSGAVNNSASARRSRSRNRAAAVA 322
            .|                        :|.|.|..:.|.|....|                     
  Rat   158 RG------------------------RGGPGRGGLGRGAMGRGG--------------------- 177

  Fly   323 AAAIAATVQGRANPRQRRGRSAGAAKGKIIRNGKADKNAKVKATNGVKSGPQQQVRRGRSRSRKP 387
                   :.||......|||.....:|                             |||.|.|  
  Rat   178 -------IGGRGRGMIGRGRGGFGGRG-----------------------------RGRGRGR-- 204

  Fly   388 TGKPQRPEVKREDLDMELDQYMSTTKSEMD 417
             |...||.:.:|.||.:||.|||.||..:|
  Rat   205 -GALTRPVLTKEQLDNQLDAYMSKTKGHLD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9775NP_001262257.1 FoP_duplication 360..420 CDD:290576 19/58 (33%)
Chtopl1XP_003749859.2 FoP_duplication <208..244 CDD:404706 13/26 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.