DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9775 and CHTOP

DIOPT Version :9

Sequence 1:NP_001262257.1 Gene:CG9775 / 40576 FlyBaseID:FBgn0037261 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001193541.1 Gene:CHTOP / 26097 HGNCID:24511 Length:249 Species:Homo sapiens


Alignment Length:418 Identity:95/418 - (22%)
Similarity:125/418 - (29%) Gaps:202/418 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TGISLNERFTQM-QSKQPPQGRGRSRSRSRSRRIVSSGAGNQGMSAVNSRLLNEFKRLHTVQTAL 66
            |.:|||||||.| ::|||.....|:..:.:          .|..||.|.||..:.:...:||.||
Human    15 TKMSLNERFTNMLKNKQPTPVNIRASMQQQ----------QQLASARNRRLAQQMENRPSVQAAL 69

  Fly    67 KLKRRSLRTTAVSGRGPRVAGVKSLRLAPNGKPIRSNNVTRVATMRADLVASGNAARNRRSGSSM 131
            |||::||:        .|:.  ||...|..|:||                  |..||....|   
Human    70 KLKQKSLK--------QRLG--KSNIQARLGRPI------------------GALARGAIGG--- 103

  Fly   132 RNVPATNGG--GGGLRQRLGQRRPSVGGAAERVERRQRQQQQAPRGRSRSQSRSRHPQIQRVDRA 194
            |.:|....|  .||||          ||.|.|.                            :.|.
Human   104 RGLPIIQRGLPRGGLR----------GGRATRT----------------------------LLRG 130

  Fly   195 RSQSRGRSIGRSQSRNRDRSAQGRVPVKQRLSVKHRLGVRTGQRNNQAKIPPQRRAPSQIRGVAG 259
            ....||:::.|.          ||       :|..|:|:|.|                   ||.|
Human   131 GMSLRGQNLLRG----------GR-------AVAPRMGLRRG-------------------GVRG 159

  Fly   260 GRVEKRRSAQISQKKGVSASIAGRQGRPRRRSVARNAASSSGAVNNSASARRSRSRNRAAAVAAA 324
                                    :|.|.|..:.|.|....|                       
Human   160 ------------------------RGGPGRGGLGRGAMGRGG----------------------- 177

  Fly   325 AIAATVQGRANPRQRRGRSAGAAKGKIIRNGKADKNAKVKATNGVKSGPQQQVRRGRSRSRKPTG 389
                 :.||......|||.....:|                             |||.|.|   |
Human   178 -----IGGRGRGMIGRGRGGFGGRG-----------------------------RGRGRGR---G 205

  Fly   390 KPQRPEVKREDLDMELDQYMSTTKSEMD 417
            ...||.:.:|.||.:||.|||.||..:|
Human   206 ALARPVLTKEQLDNQLDAYMSKTKGHLD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9775NP_001262257.1 FoP_duplication 360..420 CDD:290576 19/58 (33%)
CHTOPNP_001193541.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..205 22/155 (14%)
Interaction with PRMT1. /evidence=ECO:0000250 154..207 22/155 (14%)
GAR motif, involved in 5hmC binding. /evidence=ECO:0000269|PubMed:25284789 195..204 5/37 (14%)
FoP_duplication <210..244 CDD:404706 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28NFC
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5482
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.