DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and ELO2

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_009963.1 Gene:ELO2 / 850400 SGDID:S000000630 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:330 Identity:77/330 - (23%)
Similarity:114/330 - (34%) Gaps:125/330 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWL--------------- 80
            |..|.:...:|..|::...|..|:...||..|.....::|.:....|..|               
Yeast    66 STLPPVLYAITAYYVIIFGGRFLLSKSKPFKLNGLFQLHNLVLTSLSLTLLLLMVEQLVPIIVQH 130

  Fly    81 ---FYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHA 142
               |..|.:|.|                                   .||           :|..
Yeast   131 GLYFAICNIGAW-----------------------------------TQP-----------LVTL 149

  Fly   143 CWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVW------FGVKFTPGGHSTFFGL 201
            .:..|..||.||:||.|.||:.|  ::|.||..|||...:..:      ..:.:.|..       
Yeast   150 YYMNYIVKFIEFIDTFFLVLKHK--KLTFLHTYHHGATALLCYTQLMGTTSISWVPIS------- 205

  Fly   202 LNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFIL--------IMVHAFQLLFI---- 254
            ||..||:|||.||..:|.|.:    :|||:::|..|::||:|        :...|..|.|.    
Yeast   206 LNLGVHVVMYWYYFLAARGIR----VWWKEWVTRFQIIQFVLDIGFIYFAVYQKAVHLYFPILPH 266

  Fly   255 --DCNYPKAFVWWIGMHAVMF---------FFLFNEFYKAAYR------SRMMKK-NGALANGHA 301
              ||         :|.....|         ..||..||...|:      ||::|: :|.:|   |
Yeast   267 CGDC---------VGSTTATFAGCAIISSYLVLFISFYINVYKRKGTKTSRVVKRAHGGVA---A 319

  Fly   302 KPNGY 306
            |.|.|
Yeast   320 KVNEY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 71/315 (23%)
ELO2NP_009963.1 ELO 64..307 CDD:395916 68/308 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I1570
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 1 0.950 - 0 Normalized mean entropy S2719
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9158
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.