DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and AT1G75000

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_177637.1 Gene:AT1G75000 / 843838 AraportID:AT1G75000 Length:281 Species:Arabidopsis thaliana


Alignment Length:303 Identity:58/303 - (19%)
Similarity:115/303 - (37%) Gaps:57/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SISRYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQV 74
            :|..:..|.:.|....|..:.:...:..:....::|:.::...|...|:..:|.....:::....
plant    13 TIVNFRWSPTQSYASTWSFLFTAVSSYIIAAVTLHLLLLITLSLSNRRRGFSLGPIPALHSLTIS 77

  Fly    75 VFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWL------TGHYSFRCQPVDYSNN 133
            :.||.:|...|:.                   .:..|..:.||      |....|.|.||....:
plant    78 IISAVIFVGILLS-------------------AAAEIRDTRWLWRRTRTTALQWFLCFPVGTRAS 123

  Fly   134 PRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHG---CMPMSVWFGVKFTPGGH 195
            .|.....:|   :|.|:|.....|.|.|:|::  :::...:|:..   |:.. :|.       .:
plant   124 GRVFFWSYA---FYLSRFLHLFRTFFSVIRRR--KLSFFQLINQSSLLCISF-LWL-------EY 175

  Fly   196 STFFG----LLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFI-- 254
            |..|.    ||.|..:.|:|.|..::.:|.:...:    .::...|.:....:.|....:|.|  
plant   176 SQSFQVVAILLTTVSYAVVYGYRFWTEIGLRGACF----PFVGNCQAILLGCMTVCHVGVLCIHL 236

  Fly   255 ----DCNYPKAFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKN 293
                .||...|:::...::||: ..|:.:|| ...||.|.|.|
plant   237 VKRGGCNGIGAWLFNSVLNAVI-TLLYLKFY-CKTRSMMTKAN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 53/284 (19%)
AT1G75000NP_177637.1 ELO 26..276 CDD:395916 53/287 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.