DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and ELOVL3

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_689523.1 Gene:ELOVL3 / 83401 HGNCID:18047 Length:270 Species:Homo sapiens


Alignment Length:264 Identity:70/264 - (26%)
Similarity:111/264 - (42%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYECLMGGWWGSYS 94
            ::.||   :.|.|:.|:.| |...|:.||..|||..|::::....:||       ::|       
Human    35 ATSFP---IALIYLVLIAV-GQNYMKERKGFNLQGPLILWSFCLAIFS-------ILG------- 81

  Fly    95 FRCQPVDYTDSPTSRRIGISG--WLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYFSKFTEFMDT 157
                        ..|..||.|  .|||...   |.|.:.|......:....|.:..||..|..||
Human    82 ------------AVRMWGIMGTVLLTGGLK---QTVCFINFIDNSTVKFWSWVFLLSKVIELGDT 131

  Fly   158 IFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVK-FTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGP 221
            .|.:|||:  .:..:|..||..:.:...||.| ..|.|  .:|..:|..||.:|||||...|...
Human   132 AFIILRKR--PLIFIHWYHHSTVLVYTSFGYKNKVPAG--GWFVTMNFGVHAIMYTYYTLKAANV 192

  Fly   222 QYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFI-----DCNYPKAFVWWIGMHAVMFFFLFNEFY 281
            :..|.|  ...:|:||::|..:..:.:. |.:|     .|:.....::|..:..:.:|.||..|:
Human   193 KPPKML--PMLITSLQILQMFVGAIVSI-LTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHFF 254

  Fly   282 KAAY 285
            ...|
Human   255 CQTY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 70/264 (27%)
ELOVL3NP_689523.1 ELO 29..266 CDD:307345 70/264 (27%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03203 266..270
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.