DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and ELOVL4

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_073563.1 Gene:ELOVL4 / 6785 HGNCID:14415 Length:314 Species:Homo sapiens


Alignment Length:297 Identity:117/297 - (39%)
Similarity:169/297 - (56%) Gaps:29/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFS 77
            |:..|.:|.|.:.||:|.||:|||::...|:..| .|||:.|::|:|..::..|::||...|:.:
Human    27 RWTWSIADKRVENWPLMQSPWPTLSISTLYLLFV-WLGPKWMKDREPFQMRLVLIIYNFGMVLLN 90

  Fly    78 AWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHA 142
            .::|.|..|    |||:                        ..||:.||.||||||...:|:..|
Human    91 LFIFRELFM----GSYN------------------------AGYSYICQSVDYSNNVHEVRIAAA 127

  Fly   143 CWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVH 207
            .|||:.||..|::||:||:||||::||:.|||.||..|....|.|:|:..||.:.|...||:|:|
Human   128 LWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQLNSFIH 192

  Fly   208 IVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPKAFVWWIGMHAVM 272
            ::||:||..:|.||..|||||||:|||.||::||.:.:.|....|:.||.:||...|.:..:|:.
Human   193 VIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLIQFHVTIGHTALSLYTDCPFPKWMHWALIAYAIS 257

  Fly   273 FFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKS 309
            |.|||..||...|:.....|.|..|......||..||
Human   258 FIFLFLNFYIRTYKEPKKPKAGKTAMNGISANGVSKS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 105/265 (40%)
ELOVL4NP_073563.1 ELO 41..278 CDD:279492 105/265 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..314 7/20 (35%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204 310..314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.