DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and elovl6

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001017257.2 Gene:elovl6 / 550011 XenbaseID:XB-GENE-942876 Length:265 Species:Xenopus tropicalis


Alignment Length:281 Identity:71/281 - (25%)
Similarity:105/281 - (37%) Gaps:83/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VYLVKVLGPR-LMENRKPLNLQNTLVMYNAIQVVFS--------AWLFYECLMGGWWGSYSFRCQ 98
            :|...:.|.| ||:.|:...|:..|::::....|||        |::.|..:..|...|.   |.
 Frog    39 LYAAFIFGGRHLMKQREKFELRKPLILWSLSLAVFSIFGAVRTGAYMLYILMTKGLKQSV---CD 100

  Fly    99 PVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYF--SKFTEFMDTIFFV 161
                                  .||...||.            ..|.|.|  ||..|..||||.:
 Frog   101 ----------------------QSFYYGPVS------------KFWAYAFVLSKAPELGDTIFII 131

  Fly   162 LRKKSSQVTTLHVIHHGCMPMSVWFGVK-FTPGGHSTFFGLLNTFVHIVMYTYYMFSAMGPQYQK 225
            |||:  ::..||..||..:.:..|:..| ...||  .:|..:|..||.|||:||...|.|.:..:
 Frog   132 LRKQ--KLIFLHWYHHITVLLYSWYSYKDMVAGG--GWFMTMNYGVHAVMYSYYALRAAGFRVSR 192

  Fly   226 YLWWKKYLTTLQMVQFILIMVHAFQLLFIDC--NYPKAFVW--------------WIGMHAVMFF 274
            .  :...:|..|:.|.|           |.|  || ..|.|              |..:..:.:|
 Frog   193 K--FAMLITLSQITQMI-----------IGCVVNY-LVFSWMQQGQCPSHVQNIVWSSIMYLSYF 243

  Fly   275 FLFNEFYKAAYRSRMMKKNGA 295
            .||..|:..||.::..|.:.|
 Frog   244 VLFCHFFFEAYITKTRKASKA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 70/277 (25%)
elovl6NP_001017257.2 ELO 25..262 CDD:366492 70/277 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.