DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and elovl1

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001016644.1 Gene:elovl1 / 549398 XenbaseID:XB-GENE-1014374 Length:290 Species:Xenopus tropicalis


Alignment Length:312 Identity:133/312 - (42%)
Similarity:190/312 - (60%) Gaps:34/312 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALIMKYIDSISRYMDSHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTL 66
            |::.:::.....:|.. :|||...:|:|.|||...|:.|:|||.|..||||:|.||||.:|:..:
 Frog     3 AVLSEWVQKYHNFMKG-ADSRIYDYPLMQSPFLPGAILLSYVYFVLSLGPRIMANRKPFDLKPLM 66

  Fly    67 VMYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYS 131
            |:||...|..||::.||.||                           |||||| |::||.|||.|
 Frog    67 VVYNFSLVALSAYIVYEFLM---------------------------SGWLTG-YTWRCDPVDVS 103

  Fly   132 NNPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHS 196
            :.|..||||...|.:.||||.|.:||:|||:|||:||:|.||:.||..:|.|.|:||||.|||..
 Frog   104 DTPMALRMVRVAWLFLFSKFIELLDTVFFVVRKKNSQITFLHIFHHSVLPWSWWWGVKFGPGGMG 168

  Fly   197 TFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFI---DCNY 258
            :|..::|:.||::||.||..||.||::||||||||::|.:|::||:|:.:|..|..|:   |..|
 Frog   169 SFHAMINSLVHVIMYFYYGLSAAGPRFQKYLWWKKHMTAIQLIQFVLVSIHISQYYFMSSCDYQY 233

  Fly   259 PKAFVWWIGMHAVMFFFLFNEFYKAAY-RSRMMKKNGALANGHAKPNGYCKS 309
            | .|:..|.::..:||.||:.|:..|| :.|.:.|...:|||....||..|:
 Frog   234 P-IFIHLIWIYGTVFFILFSNFWYQAYTKGRRLPKGSTVANGALHQNGKAKN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 121/269 (45%)
elovl1NP_001016644.1 ELO 27..267 CDD:395916 121/268 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 257 1.000 Domainoid score I1973
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41322
Inparanoid 1 1.050 277 1.000 Inparanoid score I2866
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9457
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.