DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and ELOVL2

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_011513018.1 Gene:ELOVL2 / 54898 HGNCID:14416 Length:326 Species:Homo sapiens


Alignment Length:360 Identity:122/360 - (33%)
Similarity:168/360 - (46%) Gaps:80/360 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DSISRYMDS---HSDSRTKGWPMMSSPFPTLAVCLTYVYLVKV-LGPRLMENRKPLNLQNTLVMY 69
            |.|:.::|:   ..|||.:||.|:.|..||.  .||.:||:.: ||.:.|:||..|:|:..|.:|
Human    39 DEINAFLDNMFGPRDSRVRGWFMLDSYLPTF--FLTVMYLLSIWLGNKYMKNRPALSLRGILTLY 101

  Fly    70 NAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNP 134
            |....:.||::..|.::..|.|.|:.:||  |.|                           |...
Human   102 NLGITLLSAYMLAELILSTWEGGYNLQCQ--DLT---------------------------SAGE 137

  Fly   135 RTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGV-KFTPGGHSTF 198
            ..:|:....|||||||..||:||||||||||:||:|.|||.||..| .::|:.| .:.|.|.|.|
Human   138 ADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASM-FNIWWCVLNWIPCGQSFF 201

  Fly   199 FGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPKAFV 263
            ...||:|:||:||:||..|.. |...||||||||||..|:|||:|.:.|....:...|.:|...:
Human   202 GPTLNSFIHILMYSYYGLSVF-PSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCL 265

  Fly   264 WWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKPNGYCKSINAHDDLAMPQTTEATATA 328
            .:...:.:....||..||...||.:.|||                      |:..|         
Human   266 IFQSSYMLTLVILFLNFYVQTYRKKPMKK----------------------DMQEP--------- 299

  Fly   329 TPASKANGSSTPPSNGHANGVENVYKQVANGSAHK 363
             ||.|.          ..||....|...|||..:|
Human   300 -PAGKE----------VKNGFSKAYFTAANGVMNK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 101/267 (38%)
ELOVL2XP_011513018.1 ELO 60..294 CDD:279492 100/266 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.