DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and elovl5

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001011248.1 Gene:elovl5 / 496694 XenbaseID:XB-GENE-952346 Length:295 Species:Xenopus tropicalis


Alignment Length:316 Identity:105/316 - (33%)
Similarity:162/316 - (51%) Gaps:36/316 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MKYID-SISRYMD---SHSDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNT 65
            |:.:| :::.|:|   ...|.|.:||.::.:..||:.....|:::| ..||:.|:||.|::.:..
 Frog     1 MEVLDKAVNGYIDHLLGPKDPRVRGWLLLDNYVPTILFTALYLFIV-WRGPKYMQNRPPVSCRGI 64

  Fly    66 LVMYNAIQVVFSAWLFYECLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDY 130
            ||:||....:.|.::|||.:.|.|.|.|:|.||..:                             
 Frog    65 LVVYNLGLTLLSLYMFYELVTGVWEGGYNFFCQDTN----------------------------- 100

  Fly   131 SNNPRTLRMVHACWWYYFSKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGH 195
            |......::|...|||||||..|||||.||:|||.:.|:|.|||.||..|....||.:.:.|.||
 Frog   101 SGGDADTKIVRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGH 165

  Fly   196 STFFGLLNTFVHIVMYTYYMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFIDCNYPK 260
            |.|...||:|:|::||:||..||: |..:.|||||||:|..|:.||:|.|......:...|.:|.
 Frog   166 SYFGATLNSFIHVLMYSYYGLSAI-PAMRPYLWWKKYITQCQLTQFVLTMTQTTCAMIWPCKFPM 229

  Fly   261 AFVWWIGMHAVMFFFLFNEFYKAAYRSRMMKKNGALANGHAKP-NGYCKSINAHDD 315
            .::::...:.:....||..||...|..:...:.....||.|.. ||:..|.::.:|
 Frog   230 GWLYFQNCYMISLIILFGNFYIKTYNKKTSSRRKEYQNGSASAVNGHTNSFSSLED 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 90/265 (34%)
elovl5NP_001011248.1 ELO 28..261 CDD:366492 90/263 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.