DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31522 and elovl7

DIOPT Version :9

Sequence 1:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001005456.1 Gene:elovl7 / 448054 XenbaseID:XB-GENE-942805 Length:299 Species:Xenopus tropicalis


Alignment Length:299 Identity:134/299 - (44%)
Similarity:179/299 - (59%) Gaps:39/299 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SDSRTKGWPMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYE 83
            :|.|.:.||:||:|.|...:...|:|.|..||||:||||||..|:..:..||...|:||.::.||
 Frog    21 ADPRVEDWPLMSTPIPQTIIIGAYIYFVTSLGPRIMENRKPFALKEIMACYNLFMVLFSLYMCYE 85

  Fly    84 CLMGGWWGSYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPVDYSNNPRTLRMVHACWWYYF 148
            .||                           |||..| ||:||..||||.:|:.|||...||.:||
 Frog    86 FLM---------------------------SGWAAG-YSYRCDIVDYSQSPQALRMAWTCWLFYF 122

  Fly   149 SKFTEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTPGGHSTFFGLLNTFVHIVMYTY 213
            |||.|.:||:|||||||:||:|.|||.||..||.:.||||||..||..||..|:|..||::||:|
 Frog   123 SKFIELLDTVFFVLRKKNSQITFLHVYHHSIMPWTWWFGVKFAAGGLGTFHALVNCVVHVIMYSY 187

  Fly   214 YMFSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLFID-C--NYPKAFVWWIGMHAVMFFF 275
            |..||:||.||||||||||:|::|:.||:::..|..|..|:: |  .|| .|::.|.::..:|..
 Frog   188 YGLSALGPAYQKYLWWKKYMTSIQLTQFLMVTFHIGQFFFMENCPYQYP-IFLYVIWLYGFVFLL 251

  Fly   276 LFNEFYKAAY-RSRMMKKNGALANGHAK----PNGYCKS 309
            ||..|:..|| :.:.:.||  |.|||.|    .|..||:
 Frog   252 LFLNFWFHAYTKGQRLPKN--LQNGHCKNNNQENAQCKN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31522NP_001262254.1 ELO 27..293 CDD:279492 121/269 (45%)
elovl7NP_001005456.1 ELO 29..228 CDD:395916 109/226 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 257 1.000 Domainoid score I1973
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 277 1.000 Inparanoid score I2866
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9457
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.